Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PEMT (Phosphatidylethanolamine N-methyltransferase) Full Length (CAT#: MPC4476K) Made to Order

This product is a made-to-order Human PEMT membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PEMT
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 4
  • Sequence
  • MTRLLGYVDPLDPSFVAAVITITFNPLYWNVVARWEHKTRKLSRAFGSPY
    LACYSLSVTILLLNFLRSHCFTQAMLSQPRMESLDTPAAYSLGLALLGLG
    VVLVLSSFFALGFAGTFLGDYFGILKEARVTVFPFNILDNPMYWGSTANY
    LGWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • PEMT
  • Full Name
  • Phosphatidylethanolamine N-methyltransferase
  • Introduction
  • Phosphatidylcholine (PC) is the most abundant mammalian phospholipid. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. Another distinct synthetic pathway in nucleated cells converts intracellular choline to phosphatidylcholine by a three-step process. The protein isoforms encoded by this gene localize to the endoplasmic reticulum and mitochondria-associated membranes. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
  • Alternative Names
  • PEMT; PLMT; PNMT; PEAMT; PEMPT; PEMT2; phospholipid methyltransferase; Phosphatidylethanolamine N-methyltransferase

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us