Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PEX11A (Peroxisomal biogenesis factor 11 alpha) Full Length (CAT#: MPC4326K) Made to Order

This product is a made-to-order Human PEX11A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PEX11A
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MDAFTRFTNQTQGRDRLFRATQYTCMLLRYLLEPKAGKEKVVMKLKKLES
    SVSTGRKWFRLGNVVHAIQATEQSIHATDLVPRLCLTLANLNRVIYFICD
    TILWVRSVGLTSGINKEKWRTRAAHHYYYSLLLSLVRDLYEISLQMKRVT
    CDRAKKEKSASQDPLWFSVAEEETEWLQSFLLLLFRSLKQHPPLLLDTVK
    NLCDILNPLDQLGIYKSNPGIIGLGGLVSSIAGMITVAYPQMKLKTR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • PEX11A
  • Full Name
  • Peroxisomal biogenesis factor 11 alpha
  • Introduction
  • This gene is a member of the PEX11 family, which is composed of membrane elongation factors involved in regulation of peroxisome maintenance and proliferation. This gene product interacts with peroxisomal membrane protein 19 and may respond to outside stimuli to increase peroxisome abundance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
  • Alternative Names
  • PEX11A; PMP28; hsPEX11p; PEX11-ALPHA; peroxisomal membrane protein 11A; 28 kDa peroxisomal integral membrane protein; peroxin-11A; peroxisomal biogenesis factor 11A; protein PEX11 homolog alpha; Peroxisomal biogenesis factor 11 alpha

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us