Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PIEZO1 Expressed in E. coli expression system, Partial (2198-2431AA) (CAT#: S01YF-0624-KX13)

This product is recombinant Human PIEZO1 protein.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PIEZO1
  • Protein Length
  • ECD
  • Molecular Weight
  • 33.6 kDa
  • Sequence
  • RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS

Product Description

  • Expression Systems
  • E. coli expression system
  • Tag
  • 10xHis tag at the N-terminus and Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PIEZO1
  • Full Name
  • Piezo type mechanosensitive ion channel component 1
  • Introduction
  • The protein encoded by this gene is a mechanically-activated ion channel that links mechanical forces to biological signals. The encoded protein contains 36 transmembrane domains and functions as a homotetramer. Defects in this gene have been associated with dehydrated hereditary stomatocytosis.
  • Alternative Names
  • DHS; Mib; LMPH3; FAM38A; LMPHM6; piezo-type mechanosensitive ion channel component 1; family with sequence similarity 38, member A; membrane protein induced by beta-amyloid treatment; PIEZO1; Piezo type mechanosensitive ion channel component 1
  • Gene ID
  • 9780
  • UniProt ID
  • Q92508

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us