Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PIEZO2 Expressed in E. coli expression system, Partial (2427-2661AA) (CAT#: S01YF-0624-KX14)

This product is recombinant Human PIEZO2 protein.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PIEZO2
  • Protein Length
  • ECD
  • Molecular Weight
  • 33.3 kDa
  • Sequence
  • KSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQLKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHELLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTPVTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILSRDNTTKYNSEWWVLNLTGNRIYNPNSQALELVVFNDKVSPPS

Product Description

  • Expression Systems
  • E. coli expression system
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • PIEZO2
  • Full Name
  • Piezo type mechanosensitive ion channel component 2
  • Introduction
  • The protein encoded by this gene contains more than thirty transmembrane domains and likely functions as part of mechanically-activated (MA) cation channels. These channels serve to connect mechanical forces to biological signals. The encoded protein quickly adapts MA currents in somatosensory neurons. Defects in this gene are a cause of type 5 distal arthrogryposis. Several alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known.
  • Alternative Names
  • DA3; DA5; MWKS; DAIPT; FAM38B; HsT748; HsT771; FAM38B2; C18orf30; C18orf58; piezo-type mechanosensitive ion channel component 2; PIEZO2 variant 16; family with sequence similarity 38, member A pseudogene; family with sequence similarity 38, member B2; piezo-type mechanosensitive ion channel component 1 pseudogene; protein PIEZO2; PIEZO2; Piezo type mechanosensitive ion channel component 2
  • Gene ID
  • 63895
  • UniProt ID
  • Q9H5I5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us