Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human PLA2R1 (Phospholipase A2 receptor 1) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (395-530aa) (CAT#: MPX4497K)

This product is a 19.4kDa Human PLA2R1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • PLA2R1
  • Protein Length
  • Partial (395-530aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 19.4kDa
  • TMD
  • 1
  • Sequence
  • EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • PLA2R1
  • Full Name
  • Phospholipase A2 receptor 1
  • Introduction
  • This gene represents a phospholipase A2 receptor. The encoded protein likely exists as both a transmembrane form and a soluble form. The transmembrane receptor may play a role in clearance of phospholipase A2, thereby inhibiting its action. Polymorphisms at this locus have been associated with susceptibility to idiopathic membranous nephropathy. Alternatively spliced transcript variants encoding different isoforms have been identified.
  • Alternative Names
  • PLA2R1; PLA2R; PLA2-R; PLA2IR; CLEC13C; PLA2G1R; secretory phospholipase A2 receptor; 180 kDa secretory phospholipase A2 receptor; C-type lectin domain family 13 member C; M-type receptor; phospholipase A2 receptor 1, 180kD; phospholipase A2 receptor 1, 180kDa; Phospholipase A2 receptor 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us