Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RELT (RELT TNF receptor) Expressed in NS0 for Antibody Discovery, Partial (26-160aa, R127G&R129G) (CAT#: MPX0816K)

This product is a 41 kDa Human RELT membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RELT
  • Protein Length
  • Partial (26-160aa, R127G&R129G)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 41 kDa
  • TMD
  • 1
  • Sequence
  • STTLWQCPPGEEPDLDPGQGTLCRP
    CPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGP
    WGVPRVPCQPCSWAPLGTHGCDEWGRGAGRGVEVAAGASSGGETRQPGNG
    TRAGGPEETA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >90%, by SDS-PAGE under reducing conditions and visualized by silver stain
  • Buffer
  • Supplied as a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • RELT
  • Full Name
  • RELT TNF receptor
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.
  • Alternative Names
  • RELT; AI3C; TRLT; TNFRSF19L; tumor necrosis factor receptor superfamily member 19L; RELT tumor necrosis factor receptor; receptor expressed in lymphoid tissues; RELT TNF receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us