Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RGS9BP (Regulator of G protein signaling 9 binding protein) Full Length (CAT#: MPC4229K) Made to Order

This product is a made-to-order Human RGS9BP membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RGS9BP
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MAREECKALLDGLNKTTACYHHLVLTVGGSADSQNLRQELQKTRQKAQEL
    AVSTCARLTAVLRDRGLAADERAEFERLWVAFSGCLDLLEADMRRALELG
    AAFPLHAPRRPLVRTGVAGASSGVAARALSTRSLRLEAEGDFDVADLREL
    EREVLQVGEMIDNMEMKVNVPRWTVQARQAAGAELLSTVSAGPSSVVSLQ
    ERGGGCDPRKALAAILFGAVLLAAVALAVCVAKLS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • RGS9BP
  • Full Name
  • Regulator of G protein signaling 9 binding protein
  • Introduction
  • The protein encoded by this gene functions as a regulator of G protein-coupled receptor signaling in phototransduction. Studies in bovine and mouse show that this gene is expressed only in the retina, and is localized in the rod outer segment membranes. This protein is associated with a heterotetrameric complex, specifically interacting with the regulator of G-protein signaling 9, and appears to function as the membrane anchor for the other largely soluble interacting partners. Mutations in this gene are associated with prolonged electroretinal response suppression (PERRS), also known as bradyopsia.
  • Alternative Names
  • RGS9BP; R9AP; RGS9; PERRS; RGS9 anchor protein; RGS9-anchoring protein; Regulator of G protein signaling 9 binding protein

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us