Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human RNF144A (Ring finger protein 144A) Full Length (CAT#: MPC3743K) Made to Order

This product is a made-to-order Human RNF144A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • RNF144A
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MTTTRYRPTWDLALDPLVSCKLCLGEYPVEQMTTIAQCQCIFCTLCLKQY
    VELLIKEGLETAISCPDAACPKQGHLQENEIECMVAAEIMQRYKKLQFER
    EVLFDPCRTWCPASTCQAVCQLQDVGLQTPQPVQCKACRMEFCSTCKASW
    HPGQGCPETMPITFLPGETSAAFKMEEDDAPIKRCPKCKVYIERDEGCAQ
    MMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHSRASVIWHRTQV
    VGIFAGFGLLLLVASPFLLLATPFVLCCKCKCSKGDDDPLPT

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • RNF144A
  • Full Name
  • Ring finger protein 144A
  • Introduction
  • This gene encodes a member of a family of RING finger domain-containing E3 ubiquitin ligases that also includes parkin and parc. The expression of this gene is induced by DNA damage. The encoded protein interacts with the cytoplasmic DNA-dependent protein kinase, catalytic subunit (DNA-PKcs) and promotes its degradation through ubiquitination. The orthologous mouse protein has been shown to interact with a ubiquitin-conjugating enzyme involved in embryonic development.
  • Alternative Names
  • RNF144A; hUIP4; RNF144; UBCE7IP4; E3 ubiquitin-protein ligase RNF144A; UbcM4-interacting protein 4; probable E3 ubiquitin-protein ligase RNF144A; ring finger protein 144; ubiquitin conjugating enzyme 7 interacting protein 4; Ring finger protein 144A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us