Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SARAF (Store-operated calcium entry associated regulatory factor) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (195-339aa) (CAT#: MPX4421K)

This product is a 17.5kDa Human SARAF membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SARAF
  • Protein Length
  • Partial (195-339aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 17.5kDa
  • TMD
  • 1
  • Sequence
  • SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SARAF
  • Full Name
  • Store-operated calcium entry associated regulatory factor
  • Alternative Names
  • SARAF; XTP3; FOAP-7; TMEM66; HSPC035; store-operated calcium entry-associated regulatory factor; HBV X-transactivated gene 3 protein; HBV XAg-transactivated protein 3; SOCE-associated regulatory factor; testicular secretory protein Li 59; transmembrane protein 66; Store-operated calcium entry associated regulatory factor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us