Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SCN4B (Sodium voltage-gated channel beta subunit 4) Full Length (CAT#: MPC0706K) Made to Order

This product is a 24.9 kDa Human SCN4B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SCN4B
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 24.9 kDa
  • TMD
  • 1
  • Sequence
  • MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEIL
    LPCTFSSCFGFEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDR
    ITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENNLQHHATIFLQ
    VVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKE
    CLVSSSGNDNTENGLPGSKAEEKPPSKV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SCN4B
  • Full Name
  • Sodium voltage-gated channel beta subunit 4
  • Introduction
  • The protein encoded by this gene is one of several sodium channel beta subunits. These subunits interact with voltage-gated alpha subunits to change sodium channel kinetics. The encoded transmembrane protein forms interchain disulfide bonds with SCN2A. Defects in this gene are a cause of long QT syndrome type 10 (LQT10). Three protein-coding and one non-coding transcript variant have been found for this gene.
  • Alternative Names
  • LQT10; ATFB17; Navbeta4; sodium channel subunit beta-4; sodium channel, voltage-gated, type IV, beta subunit; SCN4B; Sodium voltage-gated channel beta subunit 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us