Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SDC4 (Syndecan 4) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (19-145aa) (CAT#: MPX4613K)

This product is a 29.9kDa Human SDC4 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SDC4
  • Protein Length
  • Partial (19-145aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 29.9kDa
  • TMD
  • 1
  • Sequence
  • ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SDC4
  • Full Name
  • Syndecan 4
  • Introduction
  • The protein encoded by this gene is a transmembrane (type I) heparan sulfate proteoglycan that functions as a receptor in intracellular signaling. The encoded protein is found as a homodimer and is a member of the syndecan proteoglycan family. This gene is found on chromosome 20, while a pseudogene has been found on chromosome 22.
  • Alternative Names
  • SDC4; SYND4; syndecan-4; amphiglycan; ryudocan amphiglycan; ryudocan core protein; syndecan 4 (amphiglycan, ryudocan); syndecan proteoglycan 4; Syndecan 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us