Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SEC11A (SEC11 homolog A, signal peptidase complex subunit) Full Length (CAT#: MPC4081K) Made to Order

This product is a made-to-order Human SEC11A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SEC11A
  • Protein Length
  • Full length
  • Protein Class
  • Protease
  • TMD
  • 1
  • Sequence
  • MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIV
    VVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLK
    IHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIG
    IVTILMNDYPKFKYAVLFLLGLFVLVHRE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • SEC11A
  • Full Name
  • SEC11 homolog A, signal peptidase complex subunit
  • Introduction
  • This gene encodes a member of the peptidase S26B family. The encoded protein is an 18kDa subunit of the signal peptidase complex and has been linked to cell migration and invasion, gastric cancer and lymph node metastasis. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 8.
  • Alternative Names
  • SEC11A; SPC18; SPCS4A; SEC11L1; sid2895; 1810012E07Rik; signal peptidase complex catalytic subunit SEC11A; SEC11-like protein 1; SPase 18 kDa subunit; endopeptidase SP18; microsomal signal peptidase 18 kDa subunit; signal peptidase complex (18kD); signal peptidase complex 18; SEC11 homolog A, signal peptidase complex subunit

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us