Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SFT2D1 (SFT2 domain containing 1) for Antibody Discovery (CAT#: MP1123X)

This product is a 44.2 kDa Human SFT2D1 membrane protein expressed in In vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SFT2D1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 44.2 kDa
  • TMD
  • 4
  • Sequence
  • MEKLRRVLSGQDDEEQGLTAQVLDASSLSFNTRLKWFAICFVCGVFFSILGTGLLWLPGGIKLFAVFYTLGNLAALASTCFLMGPVKQLKKMFEATRLLATIVMLLCFIFTLCAALWWHKKGLAVLFCILQFLSMTWYSLSYIPYARDAVIKCCSSLLS

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • In vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0

Target

  • Target Protein
  • SFT2D1
  • Full Name
  • SFT2 domain containing 1
  • Introduction
  • May be involved in fusion of retrograde transport vesicles derived from an endocytic compartment with the Golgi complex.
  • Alternative Names
  • pRGR1; C6orf83; vesicle transport protein SFT2A; SFT2 domain-containing protein 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us