Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC22A18 (Solute carrier family 22 member 18) Full Length (CAT#: MPC0774K) Made to Order

This product is a 44.8 kDa Human SLC22A18 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC22A18
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 44.8 kDa
  • TMD
  • 10
  • Sequence
  • MQGARAPRDQGRSPGRMSALGRSSVILLTYVLAATELTCLFMQFSIVPYL
    SRKLGLDSIAFGYLQTTFGVLQLLGGPVFGRFADQRGARAALTLSFLAAL
    ALYLLLAAASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAPEERP
    AALGRLGLCFGVGVILGSLLGGTLVSAYGIQCPAILAALATLLGAVLSFT
    CIPASTKGAKTDAQAPLPGGPRASVFDLKAIASLLRLPDVPRIFLVKVAS
    NCPTGLFMVMFSIISMDFFQLEAAQAGYLMSFFGLLQMVTQGLVIGQLSS
    HFSEEVLLRASVLVFIVVGLAMAWMSSVFHFCLLVPGLVFSLCTLNVVTD
    SMLIKAVSTSDTGTMLGLCASVQPLLRTLGPTVGGLLYRSFGVPVFGHVQ
    VAINTLVLLVLWRKPMPQRKDKVR

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC22A18
  • Full Name
  • Solute carrier family 22 member 18
  • Introduction
  • This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is imprinted, with preferential expression from the maternal allele. Mutations in this gene have been found in Wilms' tumor and lung cancer. This protein may act as a transporter of organic cations, and have a role in the transport of chloroquine and quinidine-related compounds in kidney. Several alternatively spliced transcript variants encoding different isoforms have been described.
  • Alternative Names
  • HET; ITM; BWR1A; IMPT1; TSSC5; ORCTL2; BWSCR1A; SLC22A1L; p45-BWR1A; solute carrier family 22 member 18; beckwith-Wiedemann syndrome chromosomal region 1 candidate gene A protein;efflux transporter-like protein; imprinted multi-membrane-spanning polyspecific transporter-related protein 1; organic cation transporter-like protein 2; p45 Beckwith-Wiedemann region 1A; tumor-suppressing STF cDNA 5 protein; tumor-suppressing subchromosomal transferable fragment candidate gene 5 protein; SLC22A18; Solute carrier family 22 member 18

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us