Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC25A29 (Solute carrier family 25 member 29) Full Length (CAT#: MPC1747K) Made to Order

This product is a 32 kDa Human SLC25A29 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC25A29
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 32 kDa
  • TMD
  • 6
  • Sequence
  • MALDFLAGCAGGVAGVLVGHPFDTVKVRLQVQSVEKPQYRGTLHCFKSII
    KQESVLGLYKGLGSPLMGLTFINALVFGVQGNTLRALGHDSPLNQFLAGA
    AAGAIQCVICCPMELAKTRLQLQDAGPARTYKGSLDCLAQIYGHEGLRGV
    NRGMVSTLLRETPSFGVYFLTYDALTRALGCEPGDRLLVPKLLLAGGTSG
    IVSWLSTYPVDVVKSRLQADGLRGAPRYRGILDCVHQSYRAEGWRVFTRG
    LASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPAAPAGPALAQP
    SSL

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC25A29
  • Full Name
  • Solute carrier family 25 member 29
  • Introduction
  • This gene encodes a nuclear-encoded mitochondrial protein that is a member of the large family of solute carrier family 25 (SLC25) mitochondrial transporters. The members of this superfamily are involved in numerous metabolic pathways and cell functions. This gene product was previously reported to be a mitochondrial carnitine-acylcarnitine-like (CACL) translocase (PMID:128829710) or an ornithine transporter (designated ORNT3, PMID:19287344), however, a recent study characterized the main role of this protein as a mitochondrial transporter of basic amino acids, with a preference for arginine and lysine (PMID:24652292). Alternatively spliced transcript variants have been found for this gene.
  • Alternative Names
  • SLC25A29; CACL; ORNT3; C14orf69; mitochondrial basic amino acids transporter; carnitine-acylcarnitine translocase like; mitochondrial carnitine/acylcarnitine carrier protein CACL; mitochondrial ornithine transporter 3; solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29; Solute carrier family 25 member 29

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us