Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC31A1 (Solute carrier family 31 member 1) Full Length (CAT#: MPC0831K) Made to Order

This product is a 21 kDa Human SLC31A1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC31A1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 21 kDa
  • TMD
  • 3
  • Sequence
  • MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSHGGGDSSMMMMPMTFYFG
    FKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVS
    IRYNSMPVPGPNGTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISYFLM
    LIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC31A1
  • Full Name
  • Solute carrier family 31 member 1
  • Introduction
  • The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.
  • Alternative Names
  • CTR1; COPT1; high affinity copper uptake protein 1; copper transport 1 homolog; copper transporter 1; solute carrier family 31 (copper transporter), member 1; solute carrier family 31 (copper transporters), member 1; SLC31A1; Solute carrier family 31 member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us