Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC34A2 (Solute carrier family 34 member 2) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (574-689aa) (CAT#: MPX4378K)

This product is a 15.1kDa Human SLC34A2 membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC34A2
  • Protein Length
  • Partial (574-689aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 15.1kDa
  • TMD
  • 8
  • Sequence
  • LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • SLC34A2
  • Full Name
  • Solute carrier family 34 member 2
  • Introduction
  • The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.
  • Alternative Names
  • PULAM; NPTIIb; NAPI-3B; NAPI-IIb; sodium-dependent phosphate transport protein 2B; sodium/phosphate cotransporter 2B; solute carrier family 34 (sodium phosphate), member 2; solute carrier family 34 (type II sodium/phosphate cotransporter), member 2; type II sodium-dependent phosphate transporter 3b; SLC34A2; Solute carrier family 34 member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us