Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC35A1 (Solute carrier family 35 member A1) Full Length (CAT#: MPC1120K) Made to Order

This product is a 36.7 kDa Human SLC35A1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC35A1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 36.7 kDa
  • TMD
  • 10
  • Sequence
  • MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCI
    TEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV
    QNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFM
    LCAGVTLVQWKPAQATKVVVEQNPLLGFGAIAIAVLCSGFAGVYFEKVLK
    SSDTSLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKGFFYGYTYYVWFVI
    FLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVMLFGLQITLTFA
    LGTLLVCVSIYLYGLPRQDTTSIQQGETASKERVIGV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC35A1
  • Full Name
  • Solute carrier family 35 member A1
  • Introduction
  • The protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently glycosylated. Defects in this gene are a cause of congenital disorder of glycosylation type 2F (CDG2F). Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • SLC35A1; CST; hCST; CDG2F; CMPST; CMP-sialic acid transporter; CMP-SA-Tr; CMP-Sia-Tr; mutated CMP-sialic acid transporter A1; solute carrier family 35 (CMP-sialic acid transporter), member 1; solute carrier family 35 (CMP-sialic acid transporter), member A1; solute carrier family 35 (UDP-galactose transporter), member 1; Solute carrier family 35 member A1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us