Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC5A2 (Solute carrier family 5 member 2) Expressed in vitro E.coli expression system for Antibody Discovery, Partial (1-102aa) (CAT#: MPX0853K)

This product is a 30.5kDa Human SLC5A2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC5A2
  • Protein Length
  • Partial (1-102aa)
  • Protein Class
  • Transport
  • Molecular Weight
  • 30.5kDa
  • TMD
  • 11
  • Sequence
  • MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SLC5A2
  • Full Name
  • Solute carrier family 5 member 2
  • Introduction
  • This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. Two transcript variants, one protein-coding and one not, have been found for this gene.
  • Alternative Names
  • SLC5A2; SGLT2; sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; low affinity sodium-glucose cotransporter; solute carrier family 5 (sodium/glucose cotransporter), member 2; solute carrier family 5 (sodium/glucose transporter), member 2; Solute carrier family 5 member 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us