Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC7A5 (Solute carrier family 7 member 5) Expressed in E.coli with 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (16-50aa) (CAT#: MPX4142K)

This product is a 19.7 kDa Human SLC7A5 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC7A5
  • Protein Length
  • Partial (16-50aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 19.7 kDa
  • TMD
  • 12
  • Sequence
  • AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis and SUMO tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • SLC7A5
  • Full Name
  • Solute carrier family 7 member 5
  • Alternative Names
  • E16; CD98; LAT1; 4F2LC; MPE16; D16S469E; large neutral amino acids transporter small subunit 1; 4F2 light chain; CD98 light chain; L-type amino acid transporter 1; integral membrane protein E16; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (amino acid transporter light chain, L system), member 5; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; SLC7A5; Solute carrier family 7 member 5

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us