Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC7A5P1 (Solute carrier family 7 member 5 pseudogene 1) Full Length (CAT#: MPC2228K) Made to Order

This product is a 18.7 kDa Human SLC7A5P1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC7A5P1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 18.7 kDa
  • TMD
  • 3
  • Sequence
  • MAGAGPKRRALAAPVAEEKEEAREKMLASKRADGAAPAGEGEGVTLQRNI
    TLLNGVAIIVGAIIGSGIFVTPTGVLKEAGSPGLALVMWAACGVFSIVGA
    LCYAELGTTISKSGGDYAYMLDVYGSLPAFLKLWIELLVIRPSSQYIVAL
    VFATYLLKPLFPSCPVPEEAAKLMACHCVH

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • SLC7A5P1
  • Full Name
  • Solute carrier family 7 member 5 pseudogene 1
  • Alternative Names
  • SLC7A5P1; DC49; MLAS; LAT1-3TM; hLAT1-3TM; SLC7A5 pseudogene; hLAT1 3-transmembrane protein MLAS; putative L-type amino acid transporter 1-like protein MLAS; solute carrier family 7 (amino acid transporter light chain, L system), member 5 pseudogene 1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5 pseudogene 1; Solute carrier family 7 member 5 pseudogene 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us