Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human SLC9A1 (Solute carrier family 9 member A1) Expressed in Wheat germ for Antibody Discovery, Partial (31-130aa) (CAT#: MPX0073K)

This product is a 36 kDa Human SLC9A1 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • SLC9A1
  • Protein Length
  • Partial (31-130aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 36 kDa
  • TMD
  • 12
  • Sequence
  • VLRSHGLQLSPTASTIRSSE
    PPRERSIGDVTTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVR
    TPFEISLWILLACLMKIGFHVIPTISSIVP

Product Description

  • Expression Systems
  • Wheat germ
  • Protein Format
  • Soluble
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • SLC9A1
  • Full Name
  • Solute carrier family 9 member A1
  • Introduction
  • This gene encodes a Na+/H+ antiporter that is a member of the solute carrier family 9. The encoded protein is a plasma membrane transporter that is expressed in the kidney and intestine. This protein plays a central role in regulating pH homeostasis, cell migration and cell volume. This protein may also be involved in tumor growth.
  • Alternative Names
  • APNH; NHE1; LIKNS; NHE-1; PPP1R143; sodium/hydrogen exchanger 1; Na(+)/H(+) exchanger 1; Na-Li countertransporter; protein phosphatase 1, regulatory subunit 143; solute carrier family 9 (sodium/hydrogen exchanger), member 1 (antiporter, Na+/H+, amiloride sensitive); solute carrier family 9, subfamily A (NHE1, cation proton antiporter 1), member 1; SLC9A1; Solute carrier family 9 member A1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us