Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2) Expressed in CHO for Antibody Discovery, Partial (52-350aa) (CAT#: MPX0772K)

This product is a 35 kDa Human ST3GAL2 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST3GAL2
  • Protein Length
  • Partial (52-350aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 35 kDa
  • TMD
  • 1
  • Sequence
  • PGYAGLQRL
    SKERLSGKSCACRRCMGDAGASDWFDSHFDGNISPVWTRENMDLPPDVQRWWMMLQPQFK
    SHNTNEVLEKLFQIVPGENPYRFRDPHQCRRCAVVGNSGNLRGSGYGQDVDGHNFIMRMN
    QAPTVGFEQDVGSRTTHHFMYPESAKNLPANVSFVLVPFKVLDLLWIASALSTGQIRFTY
    APVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFG
    ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain at 5 μg per lane.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris and NaCl.

Target

  • Target Protein
  • ST3GAL2
  • Full Name
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 2
  • Introduction
  • The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein is normally found in the Golgi but can be proteolytically processed to a soluble form. This protein, which is a member of glycosyltransferase family 29, can use the same acceptor substrates as does sialyltransferase 4A.
  • Alternative Names
  • ST3GAL2; SIAT4B; ST3GALII; Gal-NAc6S; ST3GalA.2; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2; Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; SIAT4-B; ST3Gal II; alpha 2,3-ST 2; beta-galactoside alpha-2,3-sialyltransferase 2; monosialoganglioside sialyltransferase; sialyltransferase 4B (beta-galactosidase alpha-2,3-sialytransferase); ST3 beta-galactoside alpha-2,3-sialyltransferase 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us