Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ST8SIA4 (ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4) Expressed in CHO for Antibody Discovery, Partial (40-359aa) (CAT#: MPX0580K)

This product is a 37 kDa Human ST8SIA4 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ST8SIA4
  • Protein Length
  • Partial (40-359aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 37 kDa
  • TMD
  • 1
  • Sequence
  • GELSLSRSLVN
    SSDKIIRKAGSSIFQHNVEGWKINSSLVLEIRKNILRFLDAERDVSVVKS
    SFKPGDVIHYVLDRRRTLNISHDLHSLLPEVSPMKNRRFKTCAVVGNSGI
    LLDSECGKEIDSHNFVIRCNLAPVVEFAADVGTKSDFITMNPSVVQRAFG
    GFRNESDREKFVHRLSMLNDSVLWIPAFMVKGGEKHVEWVNALILKNKLK
    VRTAYPSLRLIHAVRGYWLTNKVPIKRPSTGLLMYTLATRFCDEIHLYGF
    WPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGALK
    LTTGKCVKQ

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie® Blue stain at 5 μg per lane.
  • Buffer
  • Supplied as a 0.2 μm filtered solution in Tris, NaCl and Brij-35.

Target

  • Target Protein
  • ST8SIA4
  • Full Name
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
  • Introduction
  • The protein encoded by this gene catalyzes the polycondensation of alpha-2,8-linked sialic acid required for the synthesis of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). The encoded protein, which is a member of glycosyltransferase family 29, is a type II membrane protein that may be present in the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • ST8SIA4; PST; PST1; SIAT8D; ST8SIA-IV; CMP-N-acetylneuraminate-poly-alpha-2,8-sialyltransferase; CMP-N-acetylneuraminate-poly-alpha-2,8-sialyl transferase; SIAT8-D; ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 4; ST8SiaIV; alpha-2,8-sialyltransferase 8D; polysialyltransferase-1; sialyltransferase 8 (alpha-2, 8-polysialytransferase) D; sialyltransferase 8D; sialyltransferase St8Sia IV; sialytransferase St8Sia IV; ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us