Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TAS2R1 (Taste 2 receptor member 1) Full Length (CAT#: MPC0260K) Made to Order

This product is a 34.3 kDa Human TAS2R1 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TAS2R1
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 34.3 kDa
  • TMD
  • 7
  • Sequence
  • MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRKMAPLDLLLSC
    LAVSRIFLQLFIFYVNVIVIFFIEFIMCSANCAILLFINELELWLATWLG
    VFYCAKVASVRHPLFIWLKMRISKLVPWMILGSLLYVSMICVFHSKYAGF
    MVPYFLRKFFSQNATIQKEDTLAIQIFSFVAEFSVPLLIFLFAVLLLIFS
    LGRHTRQMRNTVAGSRVPGRGAPISALLSILSFLILYFSHCMIKVFLSSL
    KFHIRRFIFLFFILVIGIYPSGHSLILILGNPKLKQNAKKFLLHSKCCQ

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TAS2R1
  • Full Name
  • Taste 2 receptor member 1
  • Introduction
  • This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. This intronless taste receptor gene encodes a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is mapped to chromosome 5p15, the location of a genetic locus (PROP) that controls the detection of the bitter compound 6-n-propyl-2-thiouracil.
  • Alternative Names
  • T2R1; TRB7; taste receptor type 2 member 1; taste receptor, family B, member 7; taste receptor, type 2, member 1; TAS2R1; Taste 2 receptor member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us