Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TAS2R16 (Taste 2 receptor member 16) Full Length (CAT#: MPC0263K) Made to Order

This product is a 33.9 kDa Human TAS2R16 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TAS2R16
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 33.9 kDa
  • TMD
  • 7
  • Sequence
  • MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVRRLMPVDMILI
    SLGISRFCLQWASMLNNFCSYFNLNYVLCNLTITWEFFNILTFWLNSLLT
    VFYCIKVSSFTHHIFLWLRWRILRLFPWILLGSLMITCVTIIPSAIGNYI
    QIQLLTMEHLPRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLM
    ASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYFLTILITIIGT
    LFDKRCWLWVWEAFVYAFILMHSTSLMLSSPTLKRILKGKC

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TAS2R16
  • Full Name
  • Taste 2 receptor member 16
  • Introduction
  • This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily. These family members are specifically expressed by taste receptor cells of the tongue and palate epithelia. Each of these apparently intronless genes encodes a 7-transmembrane receptor protein, functioning as a bitter taste receptor. This gene is clustered with another 3 candidate taste receptor genes in chromosome 7 and is genetically linked to loci that influence bitter perception.
  • Alternative Names
  • BGLPT; T2R16; taste receptor type 2 member 16; candidate taste receptor T2R16; taste receptor, type 2, member 16; TAS2R16; Taste 2 receptor member 16

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us