Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TAS2R20 (Taste 2 receptor member 20) Full Length (CAT#: MPC3211K) Made to Order

This product is a made-to-order Human TAS2R20 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TAS2R20
  • Protein Length
  • Full length
  • Protein Class
  • GPCR
  • TMD
  • 7
  • Sequence
  • MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAA
    LAVSRVGLLWVILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLAT
    SLSIFYLLKIVNFSRLIFHHLKRKAKSVVLVIVLGSLFFLVCHLVMKHTY
    INVWTEECEGNVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIY
    SLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAIYFLCLIISFW
    NFKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCW
    AKGQNQSTP

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • TAS2R20
  • Full Name
  • Taste 2 receptor member 20
  • Introduction
  • This gene encodes a member of the taste receptor two family of class C G-protein coupled receptors. Receptors of this family have a short extracellular N-terminus, seven transmembrane helices, three extracellular loops and three intracellular loops, and an intracellular C-terminus. Members of this family are expressed in a subset of taste receptor cells, where they function in bitter taste reception, as well as in non-gustatory cells including those of the brain, reproductive organs, respiratory system, and gastrointestinal system. This gene maps to the taste receptor gene cluster on chromosome 12p13.
  • Alternative Names
  • TAS2R20; T2R20; T2R49; T2R56; TAS2R49; taste receptor type 2 member 20; taste receptor type 2 member 56; taste receptor, type 2, member 49; Taste 2 receptor member 20

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us