Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TIGIT (T cell immunoreceptor with Ig and ITIM domains) Expressed in HEK293 for Antibody Discovery, Partial (22-141aa) (CAT#: MPX0552K)

This product is a 40 kDa Human TIGIT membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TIGIT
  • Protein Length
  • Partial (22-141aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 40 kDa
  • TMD
  • 1
  • Sequence
  • MMTGTIETTGNISAEKGGSIILQCHLSST
    TAQVTQVNWEQQDQLLAICNADLGWHISPSFKDRVAPGPGLGLTLQSLTV
    NDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQIP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TIGIT
  • Full Name
  • T cell immunoreceptor with Ig and ITIM domains
  • Introduction
  • This gene encodes a member of the PVR (poliovirus receptor) family of immunoglobin proteins. The product of this gene is expressed on several classes of T cells including follicular B helper T cells (TFH). The protein has been shown to bind PVR with high affinity; this binding is thought to assist interactions between TFH and dendritic cells to regulate T cell dependent B cell responses.
  • Alternative Names
  • TIGIT; VSIG9; VSTM3; WUCAM; T-cell immunoreceptor with Ig and ITIM domains; V-set and immunoglobulin domain containing 9; V-set and immunoglobulin domain-containing protein 9; V-set and transmembrane domain containing 3; V-set and transmembrane domain-containing protein 3; VSIG9, VSTM3; Washington University cell adhesion molecule; T cell immunoreceptor with Ig and ITIM domains

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us