Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TM2D1 (TM2 domain containing 1) Full Length (CAT#: MPC1724K) Made to Order

This product is a 22.3 kDa Human TM2D1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TM2D1
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 22.3 kDa
  • TMD
  • 2
  • Sequence
  • MAAAWPSGPSAPEAVTARLVGVLWFVSVTTGPWGAVATSAGGEESLKCED
    LKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHF
    TGNEVGFFKPISCRNVNGYSYKVAVALSLFLGWLGADRFYLGYPALGLLK
    FCTVGFCGIGSLIDFILISMQIVGPSDGSSYIIDYYGTRLTRLSITNETF
    RKTQLYP

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TM2D1
  • Full Name
  • TM2 domain containing 1
  • Introduction
  • The protein encoded by this gene is a beta-amyloid peptide-binding protein. It contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important in heterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neuron death and the consequent diminution of cognitive abilities observed in Alzheimer's disease. This protein may be a target of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicity through a G protein-regulated program of cell death. Several transcript variants have been found for this gene.
  • Alternative Names
  • TM2D1; BBP; TM2 domain-containing protein 1; Beta-amyloid peptide binding protein; amyloid-beta-binding protein; beta-amyloid-binding protein; hBBP; TM2 domain containing 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us