Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMCO1 (Transmembrane and coiled-coil domains 1) Full Length (CAT#: MPC1218K) Made to Order

This product is a 27 kDa Human TMCO1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMCO1
  • Protein Length
  • Full length
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 27 kDa
  • TMD
  • 2
  • Sequence
  • MPRKRKCDLRAVRVGLLLGGGGVYGSRFRFTFPGCRALSPWRVRVQRRRC
    EMSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKK
    LEKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFT
    ALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYIL
    CTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Flag or based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMCO1
  • Full Name
  • Transmembrane and coiled-coil domains 1
  • Introduction
  • This locus encodes a transmembrane protein. Mutations at this locus have been associated with craniofacial dysmorphism, skeletal anomalies, and cognitive disability. Mutations at this locus have also been associated with open angle glaucoma blindness. Alternatively spliced transcript variants have been described.
  • Alternative Names
  • TMCO1; PCIA3; TMCC4; HP10122; PNAS-136; calcium load-activated calcium channel; CLAC channel; Ca(2+) load-activated Ca(2+) channel; putative membrane protein; transmembrane and coiled-coil domain-containing protein 1; transmembrane and coiled-coil domains 4; xenogeneic cross-immune protein PCIA3; Transmembrane and coiled-coil domains 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us