Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM126B (Transmembrane protein 126B) Full Length (CAT#: MPC1654K) Made to Order

This product is a 25.9 kDa Human TMEM126B membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM126B
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 25.9 kDa
  • TMD
  • 4
  • Sequence
  • MVVFGYEAGTKPRDSGVVPVGTEEAPKVFKMAASMHGQPSPSLEDAKLRR
    PMVIEIIEKNFDYLRKEMTQNIYQMATFGTTAGFSGIFSNFLFRRCFKVK
    HDALKTYASLATLPFLSTVVTDKLFVIDALYSDNISKENCVFRSSLIGIV
    CGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLCQTQMKLMAIP
    LVFQIMFGILNGLYHYAVFEETLEKTIHEE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMEM126B
  • Full Name
  • Transmembrane protein 126B
  • Introduction
  • This gene encodes a mitochondrial transmembrane protein which is a component of the mitochondrial complex I assembly complex. The encoded protein serves as an assembly factor that is required for formation of the membrane arm of the complex. It interacts with NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 13. Naturally occurring mutations in this gene are associated with isolated complex I deficiency. A pseudogene of this gene has been defined on chromosome 9.
  • Alternative Names
  • TMEM126B; HT007; MC1DN29; complex I assembly factor TMEM126B, mitochondrial; Transmembrane protein 126B

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us