Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM183BP (Transmembrane protein 183B, pseudogene) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1742K)

This product is a Human TMEM183BP membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM183BP
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 1
  • Sequence
  • MARGPGPLGRPRPDTVAMPKRGKRLKFRAHDACSGRVTVADYADSDLAVVRSGRVKKAVANAVRQEVKSLCGLEASQVPAEEALSGAGEPYDIIDSSDEMDAQEENIHERTVSRKKKSKRHKEELDGAGGEEYPMDIWLLLASYIRPEDIVNFSLICKNAWTVTCTAAFWTRLYRRHYTLDASLPLRLRPESMEKLHCLRACVIRSLYHMYEPFAARISKNPAIPESTPSTLKNSKCLLFWCRKIVGNRQEPMWEFNFKFKKQSPRLKSKCTGGLQPPVQYEDVHTNPDQDCCLLQVTTLNFIFIPIVMGMIFTLFTINVSTDMRHHRVRLVFQDSPVHGGRKLRSEQGVQVILDPVHSVRLFDWWHPQYPFSLRA

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TMEM183BP
  • Full Name
  • Transmembrane protein 183B, pseudogene
  • Introduction
  • This locus was thought to represent a pseudogene of chromosome 1 open reading frame 37 because it is intronless and retains a polyA tail at the 3' end. It does however contain a complete open reading frame that subsequent research has demonstrated to be transcribed in a limited number of human tissues. The encoded protein may represent a transmembrane protein associated with cell membranes and be involved in cell-cell or cell-environment interactions.
  • Alternative Names
  • TMEM183BP; TMEM183B; C1ORF37DUP; C1orf37-DUP; transmembrane protein 183B; Transmembrane protein 183B, pseudogene

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us