Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM219 (Transmembrane protein 219) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (39-204aa) (CAT#: MPX4141K)

This product is a 22.7 kDa Human TMEM219 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM219
  • Protein Length
  • Partial (39-204aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 22.7 kDa
  • TMD
  • 1
  • Sequence
  • SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • TMEM219
  • Full Name
  • Transmembrane protein 219
  • Alternative Names
  • TMEM219; IGFBP-3R; insulin-like growth factor-binding protein 3 receptor; testicular tissue protein Li 203; Transmembrane protein 219

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us