Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMEM50A (Transmembrane protein 50A) Full Length (CAT#: MPC1318K) Made to Order

This product is a 17.4 kDa Human TMEM50A membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMEM50A
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 17.4 kDa
  • TMD
  • 4
  • Sequence
  • MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMK
    DFNHSYHACGVIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVG
    FMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFIFFGGLVFKFG
    RTEDLWQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TMEM50A
  • Full Name
  • Transmembrane protein 50A
  • Introduction
  • This gene is located in the RH gene locus, between the RHD and RHCE genes. The function of its protein product is unknown; however, its sequence has potential transmembrane domains suggesting that it may be an integral membrane protein. Its position between the RH genes suggests that polymorphisms in this gene may be tightly linked to RH haplotypes and may contribute to selective pressure for or against certain RH haplotypes.
  • Alternative Names
  • TMEM50A; SMP1; IFNRC; cervical cancer oncogene 9; small membrane protein 1; UNQ386/PRO718; Transmembrane protein 50A

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us