Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TMPRSS13 (Transmembrane serine protease 13) Expressed in Wheat germ for Antibody Discovery, Partial (182-279aa) (CAT#: MPX0117K)

This product is a 40 kDa Human TMPRSS13 membrane protein expressed in Wheat germ. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TMPRSS13
  • Protein Length
  • Partial (182-279aa)
  • Protein Class
  • Protease
  • Molecular Weight
  • 40 kDa
  • TMD
  • 1
  • Sequence
  • DGVVDCKLKSDELGCVRFDWDKSLLKIYSGSSHQWLPICSSNWNDSYSEKTCQQLGFESAHRTTEVAHRDFANSFSILRYNSTIQESLHRSECPSQRY

Product Description

  • Expression Systems
  • Wheat germ
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • pH: 8.00, Constituents: 0.31% Glutathione, 0.79% Tris HCl

Target

  • Target Protein
  • TMPRSS13
  • Full Name
  • Transmembrane serine protease 13
  • Introduction
  • This gene encodes a member of the type II transmembrane serine protease family. Transmembrane serine proteases are regulated by protease inhibitors and known to function in development, homeostasis, infection, and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene.
  • Alternative Names
  • TMPRSS13; MSP; MSPL; MSPS; TMPRSS11; transmembrane protease serine 13; membrane-type mosaic serine protease; transmembrane protease, serine 11; transmembrane protease, serine 13; Transmembrane serine protease 13

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us