Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF10A (TNF receptor superfamily member 10a) Expressed in CHO for Antibody Discovery, Partial (109-239aa) (CAT#: MPX0713K)

This product is a 40.9 kDa Human TNFRSF10A membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF10A
  • Protein Length
  • Partial (109-239aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 40.9 kDa
  • TMD
  • 1
  • Sequence
  • ATIKLHDQSIGT
    QQWEHSPLGELCPPGSHRSERPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPC
    TTTRNTACQCKPGTFRNDNSAEMCRKCSTGCPRGMVKVKDCTPWSDIECVHKESGNGHN

Product Description

  • Activity
  • Yes
  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • TNFRSF10A
  • Full Name
  • TNF receptor superfamily member 10a
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
  • Alternative Names
  • TNFRSF10A; DR4; APO2; CD261; TRAILR1; TRAILR-1; tumor necrosis factor receptor superfamily member 10A; TNF-related apoptosis-inducing ligand receptor 1; TRAIL receptor 1; TRAIL-R1; cytotoxic TRAIL receptor; death receptor 4; tumor necrosis factor receptor superfamily member 10a variant 2; tumor necrosis factor receptor superfamily, member 10a; TNF receptor superfamily member 10a

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us