Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF10C (TNF receptor superfamily member 10c) Full Length (CAT#: MPC2119K) Made to Order

This product is a 27.4 kDa Human TNFRSF10C membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF10C
  • Protein Length
  • Full length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 27.4 kDa
  • Sequence
  • MARIPKTLKFVVVIVAVLLPVLAYSATTARQEEVPQQTVAPQQQRHSFKG
    EECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSS
    CTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCV
    EEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTT
    SPGTPAPAAEETMTTSPGTPAPAAEETMITSPGTPASSHYLSCTIVGIIV
    LIVLLIVFV

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TNFRSF10C
  • Full Name
  • TNF receptor superfamily member 10c
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains an extracellular TRAIL-binding domain and a transmembrane domain, but no cytoplasmic death domain. This receptor is not capable of inducing apoptosis, and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis. This gene was found to be a p53-regulated DNA damage-inducible gene. The expression of this gene was detected in many normal tissues but not in most cancer cell lines, which may explain the specific sensitivity of cancer cells to the apoptosis-inducing activity of TRAIL.
  • Alternative Names
  • TNFRSF10C; LIT; DCR1; TRID; CD263; TRAILR3; TRAIL-R3; DCR1-TNFR; tumor necrosis factor receptor superfamily member 10C; TNF-related apoptosis-inducing ligand receptor 3; antagonist decoy receptor for TRAIL/Apo-2L; cytotoxic TRAIL receptor-3; decoy TRAIL receptor without death domain; decoy receptor 1; lymphocyte inhibitor of TRAIL; tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain; TNF receptor superfamily member 10c

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us