Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF13C (TNF receptor superfamily member 13C) Full Length (CAT#: MPC1256K) Made to Order

This product is a 18.8 kDa Human TNFRSF13C membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF13C
  • Protein Length
  • Full length
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 18.8 kDa
  • TMD
  • 1
  • Sequence
  • MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASS
    PAPRTALQPQESVGAGAGEAALPLPGLLFGAPALLGLALVLALVLVGLVS
    WRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDATAPAWPPPGE
    DPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • TNFRSF13C
  • Full Name
  • TNF receptor superfamily member 13C
  • Introduction
  • B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
  • Alternative Names
  • TNFRSF13C; BAFFR; CD268; CVID4; BAFF-R; BROMIX; prolixin; tumor necrosis factor receptor superfamily member 13C; B cell-activating factor receptor; BAFF receptor; BLyS receptor 3; TNF receptor superfamily member 13C

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us