Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF13B (TNF receptor superfamily member 13B) Expressed in E.coli for Antibody Discovery, Partial (1-160aa) (CAT#: MPX0115K)

This product is a 18 kDa Human TNFRSF13B membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF13B
  • Protein Length
  • Partial (1-160aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 18 kDa
  • TMD
  • 1
  • Sequence
  • MSGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQV

Product Description

  • Expression Systems
  • E.coli
  • Protein Format
  • Soluble
  • Endotoxin
  • < 1.0 EU per 1 μg
  • Purity
  • >95% as determined by SDS-PAGE and HPLC.
  • Buffer
  • Constituent: PBS

Target

  • Target Protein
  • TNFRSF13B
  • Full Name
  • TNF receptor superfamily member 13B
  • Introduction
  • The protein encoded by this gene is a lymphocyte-specific member of the tumor necrosis factor (TNF) receptor superfamily. It interacts with calcium-modulator and cyclophilin ligand (CAML). The protein induces activation of the transcription factors NFAT, AP1, and NF-kappa-B and plays a crucial role in humoral immunity by interacting with a TNF ligand. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
  • Alternative Names
  • TNFRSF13B; CVID; RYZN; TACI; CD267; CVID2; IGAD2; TNFRSF14B; tumor necrosis factor receptor superfamily member 13B; transmembrane activator and CAML interactor; tumor necrosis factor receptor 13B; TNF receptor superfamily member 13B

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us