Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TNFRSF25 (TNF receptor superfamily member 25) Expressed in E.coli with 6xHis tag at the N-terminus for Antibody Discovery, Partial (25-199aa) (CAT#: MPX4644K)

This product is a 22.9kDa Human TNFRSF25 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TNFRSF25
  • Protein Length
  • Partial (25-199aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 22.9kDa
  • TMD
  • 1
  • Sequence
  • QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • TNFRSF25
  • Full Name
  • TNF receptor superfamily member 25
  • Introduction
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed preferentially in the tissues enriched in lymphocytes, and it may play a role in regulating lymphocyte homeostasis. This receptor has been shown to stimulate NF-kappa B activity and regulate cell apoptosis. The signal transduction of this receptor is mediated by various death domain containing adaptor proteins. Knockout studies in mice suggested the role of this gene in the removal of self-reactive T cells in the thymus. Multiple alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported, most of which are potentially secreted molecules. The alternative splicing of this gene in B and T cells encounters a programmed change upon T-cell activation, which predominantly produces full-length, membrane bound isoforms, and is thought to be involved in controlling lymphocyte proliferation induced by T-cell activation.
  • Alternative Names
  • TNFRSF25; DR3; TR3; DDR3; LARD; APO-3; TRAMP; WSL-1; GEF720; WSL-LR; PLEKHG5; TNFRSF12; tumor necrosis factor receptor superfamily member 25; Guanine nucleotide exchange factor 720; PH domain-containing family G member 5; Pleckstrin homology domain-containing family G member 5; apoptosis inducing receptor; apoptosis-inducing receptor AIR; apoptosis-mediating receptor DR3; apoptosis-mediating receptor TRAMP; death domain receptor 3 soluble form; death receptor beta; lymphocyte-associated receptor of death; protein WSL-1; tumor necrosis factor receptor superfamily, member 12 (translocating chain-association membrane protein); TNF receptor superfamily member 25

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us