Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human TRPA1 (Transient receptor potential cation channel subfamily A member 1) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (957-1119aa) (CAT#: MPX4637K)

This product is a 35.2kDa Human TRPA1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • TRPA1
  • Protein Length
  • Partial (957-1119aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 35.2kDa
  • TMD
  • 6
  • Sequence
  • IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLPLWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCTGEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHLEP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • TRPA1
  • Full Name
  • Transient receptor potential cation channel subfamily A member 1
  • Introduction
  • The structure of the protein encoded by this gene is highly related to both the protein ankyrin and transmembrane proteins. The specific function of this protein has not yet been determined; however, studies indicate the function may involve a role in signal transduction and growth control.
  • Alternative Names
  • TRPA1; FEPS; FEPS1; ANKTM1; ankyrin-like with transmembrane domains 1; transformation-sensitive protein p120; wasabi receptor; Transient receptor potential cation channel subfamily A member 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us