Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UBE2J2 (Ubiquitin conjugating enzyme E2 J2) Full Length (CAT#: MPC2474K) Made to Order

This product is a made-to-order Human UBE2J2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UBE2J2
  • Protein Length
  • Full length
  • Protein Class
  • Transferase
  • TMD
  • 1
  • Sequence
  • MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRG
    PEMTPYEGGYYHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDF
    HPDTWNPAWSVSTILTGLLSFMVEKGPTLGSIETSDFTKRQLAVQSLAFN
    LKDKVFCELFPEVVEEIKQKQKAQDELSSRPQTLPLPDVVPDGETHLVQN
    GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK
    YVLRSIAQE

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • UBE2J2
  • Full Name
  • Ubiquitin conjugating enzyme E2 J2
  • Introduction
  • The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.
  • Alternative Names
  • UBE2J2; NCUBE2; NCUBE-2; PRO2121; ubiquitin-conjugating enzyme E2 J2; E2 ubiquitin-conjugating enzyme J2; non-canonical ubiquitin-conjugating enzyme 2; ubiquitin conjugating enzyme 6; ubiquitin-conjugating enzyme E2, J2 (UBC6 homolog, yeast); yeast UBC6 homolog; Ubiquitin conjugating enzyme E2 J2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us