Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human UPK2 (Uroplakin 2) Full Length (CAT#: MPC2135K) Made to Order

This product is a 19.4 kDa Human UPK2 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • UPK2
  • Protein Length
  • Full length
  • Protein Class
  • Transporter
  • Molecular Weight
  • 19.4 kDa
  • TMD
  • 1
  • Sequence
  • MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPP
    CHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVSVVDSGAGFTVTR
    LSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPRRNMESIGLGM
    ARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements

Target

  • Target Protein
  • UPK2
  • Full Name
  • Uroplakin 2
  • Introduction
  • This gene encodes one of the proteins of the highly conserved urothelium-specific integral membrane proteins of the asymmetric unit membrane which forms urothelium apical plaques in mammals. The asymmetric unit membrane is believed to strengthen the urothelium by preventing cell rupture during bladder distention. The encoded protein is expressed in the peripheral blood of bladder cancer patients with transitional cell carcinomas.
  • Alternative Names
  • UPK2; UP2; UPII; uroplakin-2; uroplakin II; Uroplakin 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us