Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VAPB (VAMP associated protein B and C) Expressed in E.coli for Antibody Discovery, Partial (2-132aa) (CAT#: MPX0469K)

This product is a 15.6 kDa Human VAPB membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VAPB
  • Protein Length
  • Partial (2-132aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 15.6 kDa
  • TMD
  • 1
  • Sequence
  • AKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPR
    RYCVRPNSGIIDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTS
    DMEAVWKEAKPEDLMDSKLRCVFELPAENDKP

Product Description

  • Activity
  • Yes
  • Expression Systems
  • E.coli
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 100 μg/mL in PBS.
  • Endotoxin
  • <0.01 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • VAPB
  • Full Name
  • VAMP associated protein B and C
  • Introduction
  • The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking.
  • Alternative Names
  • VAPB; ALS8; VAP-B; VAMP-B; vesicle-associated membrane protein-associated protein B/C; VAMP (vesicle-associated membrane protein)-associated protein B and C; VAMP-associated 33 kDa protein; VAMP associated protein B and C

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us