Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VKORC1L1 (Vitamin K epoxide reductase complex subunit 1 like 1) Full Length (CAT#: MPC2914K) Made to Order

This product is a made-to-order Human VKORC1L1 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VKORC1L1
  • Protein Length
  • Full length
  • Protein Class
  • Oxidoreductase
  • TMD
  • 4
  • Sequence
  • MAAPVLLRVSVPRWERVARYAVCAAGILLSIYAYHVEREKERDPEHRALC
    DLGPWVKCSAALASRWGRGFGLLGSIFGKDGVLNQPNSVFGLIFYILQLL
    LGMTASAVAALILMTSSIMSVVGSLYLAYILYFVLKEFCIICIVTYVLNF
    LLLIINYKRLVYLNEAWKRQLQPKQD

Product Description

  • Expression Systems
  • HEK293
  • Tag
  • Based on specific requirements
  • Protein Format
  • Detergent or based on specific requirements (Detergent, Liposome, Nanodisc, Polymer, VLP)

Target

  • Target Protein
  • VKORC1L1
  • Full Name
  • Vitamin K epoxide reductase complex subunit 1 like 1
  • Introduction
  • This gene encodes an enzyme important in the vitamin K cycle, which is involved in the carboxylation of glutamate residues present in vitamin K-dependent proteins. The encoded enzyme catalyzes the de-epoxidation of vitamin K 2,3-epoxide. Oxidative stress may upregulate expression of this gene and the encoded protein may protect cells and membrane proteins form oxidative damage. This gene and a related gene (Gene ID: 79001) may have arisen by gene duplication of an ancestral gene.
  • Alternative Names
  • VKORC1L1; vitamin K epoxide reductase complex subunit 1-like protein 1; VKORC1-like protein 1; Vitamin K epoxide reductase complex subunit 1 like 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us