Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human VSIR (V-set immunoregulatory receptor) Expressed in NS0 for Antibody Discovery, Partial (33-194aa) (CAT#: MPX0698K)

This product is a 45 kDa Human VSIR membrane protein expressed in NS0. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • VSIR
  • Protein Length
  • Partial (33-194aa)
  • Protein Class
  • Receptor
  • Molecular Weight
  • 45 kDa
  • TMD
  • 1
  • Sequence
  • FKVATPYSLYVCPEGQNV
    TLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQTCSERRPIRNLTFQDLHLH
    HGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVE
    IRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSSQDSENITAA

Product Description

  • Activity
  • Yes
  • Expression Systems
  • NS0
  • Tag
  • hIgG1 Fc tag at the C-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose.

Target

  • Target Protein
  • VSIR
  • Full Name
  • V-set immunoregulatory receptor
  • Alternative Names
  • VSIR; B7H5; GI24; B7-H5; Dies1; PD-1H; SISP1; VISTA; PP2135; C10orf54; DD1alpha; V-type immunoglobulin domain-containing suppressor of T-cell activation; Death Domain1alpha; PDCD1 homolog; V-domain Ig suppressor of T cell activation; V-set domain-containing immunoregulatory receptor; platelet receptor GI24; sisp-1; stress-induced secreted protein-1; V-set immunoregulatory receptor

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us