Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Human ZNRF3 (Zinc and ring finger 3) Expressed in Baculovirus/Insect expression system with 6xHis tag at the C-terminus for Antibody Discovery, Partial (56-219aa) (CAT#: MPX4184K)

This product is a 23.8 kDa Human ZNRF3 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ZNRF3
  • Protein Length
  • Partial (56-219aa)
  • Protein Class
  • Transferase
  • Molecular Weight
  • 23.8 kDa
  • TMD
  • 1
  • Sequence
  • KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • 6xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ZNRF3
  • Full Name
  • Zinc and ring finger 3
  • Alternative Names
  • ZNRF3; RNF203; BK747E2.3; E3 ubiquitin-protein ligase ZNRF3; CTA-292E10.6; RING finger protein 203; RING-type E3 ubiquitin transferase ZNRF3; novel C3HC4 type Zinc finger (ring finger); zinc/RING finger protein 3; Zinc and ring finger 3

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us