Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Cers1 (Ceramide synthase 1) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2740K)

This product is a Mouse Cers1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Cers1
  • Protein Length
  • Full Length
  • Protein Class
  • Transferase
  • TMD
  • 6
  • Sequence
  • MAAAAATPRLEAPEPMPSYAQMLQRSWASALAAAQGCGDCGWGLARRGLAEHAHLAAPELLLAVLCALGWTALRWAATTHIFRPLAKRCRLQPRDAARLPESAWKLLFYLACWSYCAYLLLGTSYPFFHDPPSVFYDWRSGMAVPWDIAVAYLLQGSFYCHSIYATVYMDSWRKDSVVMLVHHVVTLLLIASSYAFRYHNVGLLVFFLHDVSDVQLEFTKLNIYFKARGGAYHRLHGLVANLGCLSFCFCWFWFRLYWFPLKVLYATCHCSLQSVPDIPYYFFFNILLLLLMVMNIYWFLYIVAFAAKVLTGQMRELEDLREYDTLEAQTAKPCKAEKPLRNGLVKDKLF

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Cers1
  • Full Name
  • Ceramide synthase 1
  • Introduction
  • This gene encodes a ceramide synthase enzyme, which catalyzes the synthesis of ceramide, the hydrophobic moiety of sphingolipids. The encoded enzyme synthesizes 18-carbon (C18) ceramide in brain neurons. Mice lacking a functional copy of this gene exhibit impaired cerebellar development, locomotion and motor coordination. This protein is transcribed from a bicistronic mRNA, which also encodes growth differentiation factor 1.
  • Alternative Names
  • Cers1; L; t; to; Cer; Uog-; Lass1; Uog-1; LAG1 homolog, ceramide synthase 1; LAG1 longevity assurance homolog 1; longevity assurance gene 1 protein homolog 1; longevity assurance homolog 1; protein UOG-1; Ceramide synthase 1

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us