Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Mouse Popdc2 (Popeye domain containing 2) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX1725K)

This product is a Mouse Popdc2 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Mouse
  • Target Protein
  • Popdc2
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • TMD
  • 2
  • Sequence
  • MSANGSSVAQLLWQPPVCRSWKPDVEGAVYHLANCFLLMGFMAGSGVYGCFYLFGILGPGYLCCVLWGWFDACGLDIVLWNVLLTVACLLQLAQLVYRVRVNTLPEEFNLLYRTLCLPLQVPLQVYKEIVHCCHEQVLTLATEQTYAVEGETPINRLSLLLSGRVRVSQDGQFLHYIFPYQFMDSPEWESLHPSEEGTFQVTLTAETECSYISWPRKNLYLLLNRERYISRLFSALLGYDISEKLYTLNDKLFAKFGLRFDIRLPSLYHVLSPSASDGEPESEKDDEEALEAAVSPAQARPICIVPTPPCSAPPATTNFPVPLPRARMPRMPRPDSGNLASRRPLQNSSQVMSRSQAPLAPIHTPEL

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • Popdc2
  • Full Name
  • Popeye domain containing 2
  • Introduction
  • This gene encodes a member of the Popeye domain containing family of membrane proteins. Proteins of this family contain three helical transmembrane domains and a conserved intracellular Popeye domain. In the adult mouse, this gene is expressed at high levels in cardiac myocytes, and mice deficient for this gene develop stress-induced cardiac pacemaker dysfunction. The protein binds to a two-pore domain potassium channel and recruits it to the plasma membrane. Cyclic adenosine monophosphate negatively regulates this interaction through the Popeye domain. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • Popdc2; P; Pop2; AV006127; popeye domain-containing protein 2; Popeye domain containing 2

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us