Close
Online Inquiry
CONTACT US
:
:
:
Call us at:
:
:
:
Fax:
Email:

MemDX™ Membrane Protein Oryza sativa subsp. japonica (Rice) LOC107276403 (Aquaporin NIP1-4) for Antibody Discovery (CAT#: MP1454J)

This product is a 28.4 kDa Oryza sativa subsp. japonica (Rice) LOC107276403 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Oryza sativa subsp. japonica (Rice)
  • Target Protein
  • LOC107276403
  • Protein Length
  • Full-length
  • Protein Class
  • Aquaporin
  • Molecular Weight
  • 28.4 kDa
  • TMD
  • 6
  • Sequence
  • MARREVDDSYTNGSVVEVVSIEEGSKMDKEDDHQNPQAPDGGDVVVCGMPMSFTFLQMLLAEFLATFFLMFAGLGAITVEEKKGAVTFPGVAVAWGAAVMAMVYAVGHVSGAHLNPAVTLGFAVAGRFPWRRAPAYALAQTAAATAASVVLRLMFGGRHAPVPATLPGGAHAQSLVIEFVITFYLMFVIMAVATDDQAVGHMAGVAVGGTIMLNVLFAGPVSGASMNPARSIGPALVGSKYTALWVYILGPFAGAAAGAWAYSLIRLTGDRTD

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-His or Tag-Free
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • LOC107276403
  • Full Name
  • Aquaporin NIP1-4
  • Introduction
  • Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.
  • Alternative Names
  • NIP1-4; Os06g0552700; LOC_Os06g35930; P0427B07.13; Aquaporin NIP1-4; NOD26-like intrinsic protein 1-4; OsNIP1;4; LOC107276403

Case Studies

Customer reviews and Q&As    

Related Products
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us